Product Description:-
Shipping Rs. 40 extra on order below Rs. 499. Subscribe Amazon Prime to get free shipping on cart below Rs. 499 | Fresh Products Free shipping above Rs. 799 (Non-prime) or above Rs. 199 (Prime Members). Fresh Products are location specific.
How to get this Deal Online?
- Click on Buy Now.
- Add product to cart.
- Login or register.
- Update or select shipping details.
- Pay the amount.
More about Deal:-
- Product 1: Pure honey - noaddedsugar, no addedc3/ C4 percent/rice/corn/ canesugar
- Product 1: Disnaohoney isloadedwithnaturalanti-oxidants,enzymesand essentialminerals
- Product 1: Disanohoneyhelpsinmanageweight-dailyif consumed withwarmwateratmorningwillshowvisibleresults
- Product 1: Helps boost immunity - its loaded with antioxidants that naturally boost immunity
- Product 2: Made from High Quality Roasted Groundnuts
- Product 2: 25% Protien per serving I Rich Source of Protein & Fibre
- Product 2: Healthy and tasty spread
- Product 2: Good Source of Vitamins E, B3 & B6