Loading...
Expired
featured-deals

DiSano Pure Honey 500 g (pack of 1) & DiSano Peanut Butter, Crunchy, 25% Protein with Vitamins & Minerals, 350g Rs. 194 - Amazon

Offers

  • Get GST invoice and save up to 28% on business purchases. Sign up for free
This offer Might be expired, visit our front page for Fresh Live Deals

Product Description:-

 

Shipping Rs. 40 extra on order below Rs. 499. Subscribe Amazon Prime to get free shipping on cart below Rs. 499 | Fresh Products Free shipping above Rs. 799 (Non-prime) or above Rs. 199 (Prime Members). Fresh Products are location specific.

How to get this Deal Online?

  1. Click on Buy Now.
  2. Add product to cart.
  3. Login or register.
  4. Update or select shipping details.
  5. Pay the amount.

More about Deal:-

  • Product 1: Pure honey - noaddedsugar, no addedc3/ C4 percent/rice/corn/ canesugar
  • Product 1: Disnaohoney isloadedwithnaturalanti-oxidants,enzymesand essentialminerals
  • Product 1: Disanohoneyhelpsinmanageweight-dailyif consumed withwarmwateratmorningwillshowvisibleresults
  • Product 1: Helps boost immunity - its loaded with antioxidants that naturally boost immunity
  • Product 2: Made from High Quality Roasted Groundnuts
  • Product 2: 25% Protien per serving I Rich Source of Protein & Fibre
  • Product 2: Healthy and tasty spread
  • Product 2: Good Source of Vitamins E, B3 & B6
Deal Price History
  • Posted by Ashuk on 21st Dec 15:33:07 Rs. 194 in Daily Deals

Comments

194

375

48% Off